SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011707715.1.89273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011707715.1.89273
Domain Number 1 Region: 96-548
Classification Level Classification E-value
Superfamily Sema domain 1.57e-124
Family Sema domain 0.000061
Further Details:      
 
Domain Number 2 Region: 1435-1559,1813-1997
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.97e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 1078-1149
Classification Level Classification E-value
Superfamily E set domains 0.00000000000063
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 4 Region: 899-989
Classification Level Classification E-value
Superfamily E set domains 0.00000000000098
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000249
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 991-1078
Classification Level Classification E-value
Superfamily E set domains 0.000000000616
Family Other IPT/TIG domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011707715.1.89273
Sequence length 2033
Comment PREDICTED: plexin-B [Wasmannia auropunctata]; AA=GCF_000956235.1; RF=representative genome; TAX=64793; STAX=64793; NAME=Wasmannia auropunctata; AL=Scaffold; RT=Major
Sequence
MRFLGLTQSFPKSPTVTHSQVPLPPLLHQLSLSSMSIATWFLVILATAAIDTPASTVPPI
QDNKSPHIIAQFPAGNGQRYGHFSLDANATREGALRFNHLAIDPSSGRLYGGAINRLFQL
DSNLKLEEYVSTGPRLDNPQCHATGCMTRDIPTSLMDNVNKLLVADLESQMLIACGSLLQ
GACEKYKMSNISIKPEFIPLSVAANDESSSTYAFIGPEKYNPWAQTNILYVGTTFTNKGD
YRHDVPAISSRNLDKLDFAEYTFNHQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFAPSRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDSFITSVTI
ANTESHTVAFFGTNDGVLKKVLLSGVEAFVYESVTIDKGQKIFPDTLISPDGEYIYALSN
SKITKVKVEHCSGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPT
PPVTERPNIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCTHNTSCQGIISGENQNQANLAAHGAQYCPRFVERKEPLMLPNSVPKEIVLEVEN
LPHPQVGHSGFQCIVSIEGANLKVQARVDSSRFIVCDKTIYSYEAVSGEYEAEVTVVWNT
NHHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGTSCTYRYSCLQLPFSECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCNLVDYEVSVRIVCRT
GRHEATDAASVVVGNVAGYTESMVQFNYKDIRLSGVYPSVGPQSGGTQLAITGEYLNIGS
TISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHKLTLSIDGANRTLMDNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMEC
PSPSVAKRFTSIRRSERSAATITQGTSSPHSLRLKESQLSLKIAFIMDNVESVKDLEKQS
LRNRLLYVEDPKFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLAL
TQLVCTPPDLQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIA
GIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDM
TDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLV
NNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNS
KHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHD
ARYSLSEERLLREQIEHTMVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPF
SLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQN
DGFSVACKPPCHNCKPSHYHPQQQPSIHPHHQSHQHLHRHSNHCSSTHLPSTPNHGLISP
VMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFTGSSK
HHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAAK
QHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSMT
EHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEFD
VIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences XP_011707715.1.89273 XP_011707716.1.89273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]