SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011710124.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011710124.1.29376
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000662
Family Cripto EGF-like domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 89-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000228
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011710124.1.29376
Sequence length 234
Comment PREDICTED: cryptic protein isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MTWRHHARFLFTVSLALQIINLGNSYQREKHNGRREEVTKVATQKHQQSPLNWTSSHSGE
VTGSAQGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCVFGTLHCLPLQTPGSCDPKDFLASHAPGRGAGGAPSLLL
LLPCALLHHLLRPDAPAHPRSLVPSVLQRERRPLRKAGTWASPFIFTVVNNRCV
Download sequence
Identical sequences A0A2K6C2C6
9544.ENSMMUP00000035962 ENSMMUP00000035962 ENSMMUP00000028481 NP_001177780.1.72884 XP_011710122.1.29376 XP_011710123.1.29376 XP_011710124.1.29376 XP_011710125.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]