SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011714646.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011714646.1.29376
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000136
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011714646.1.29376
Sequence length 208
Comment PREDICTED: proheparin-binding EGF-like growth factor [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MKLLPSVVLKLLLAAVLSALVTGESLQQLRRGLAAGTSNPDPSTGSTDQLLRLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences A0A2K5VHS5 A0A2K6BF90 F7FK53
ENSMMUP00000004371 9544.ENSMMUP00000034036 ENSMMUP00000004371 ENSMMUP00000034036 NP_001244398.1.72884 XP_005558014.1.63531 XP_011714646.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]