SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011714899.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011714899.1.29376
Domain Number 1 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 354-683
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.7e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 160-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000657
Family I set domains 0.052
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 5 Region: 81-154
Classification Level Classification E-value
Superfamily EF-hand 0.000000568
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011714899.1.29376
Sequence length 745
Comment PREDICTED: follistatin-related protein 4 isoform X4 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MPVCGSDGRFYENHCKLHRAACLLGKKITVIHSKDCFLKGDTCTIAGYARLKNVLLALQT
RLQPLREGDSRQDPASQKRLVVESLFRDLDADGSGHLSSSELAQHVLKKQDLDEDLLGCS
PGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLAPEDRVSVTTVTVGLSIVLTCAVRGYLR
PPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQV
NVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSE
LHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVF
SDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWASAVNVRNRYIYVA
QPALSRVLVVDIRAQKVLQSIGVDPLPAKLAYDKSHDQVWVLSWGDVHKSQPSLQVITEA
SAGQDQHLIRTPFAGVDDFFIPPTNLIINHIRFGFIFNKSDPAVHKVDLETLMPLKTIGL
HHHGCVPQAMAHTHLGGYFFIQCRQDSPASAARQLLVDSVTDSVVGPNGDVTGTPHTSPD
GRFIVSTAADSPWLHVQEITVRGEIQTLYDLQINPGISDLAFQRSFTESNQYNIYAALHT
EPDLLFLELSTGKVGTLKNLKEPPTGPPQPWGGARRIMRDSGLFGQYLLTPARESLFLIN
GRQNTLRCEVSGIKGGTTVVWVGEV
Download sequence
Identical sequences XP_011714899.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]