SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011716809.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011716809.1.29376
Domain Number 1 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 266-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 325-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 172-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 616-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 537-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000575
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 125-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000158
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011716809.1.29376
Sequence length 675
Comment PREDICTED: zinc finger protein 709 isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MGSPHPKRASRVVVGAVLAAGEVDRTPGHPRVWEMDSVVFEDVAVNFTQEEWALLGPSQK
KLYRDVMQETFVNLASIGENWEEKNTEDHKNQGRKLRSHMVERLCERKEGSQFGETISQT
PNPKPNKKTFTRVKPYECSMCGKDYMCHSSLNRHMRSHTEHRSYEYHKYGEKSYECKECG
KRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPSSFQIHERTHTGEKPYECKECGKAFI
YHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAFRYYQT
FQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPSSFRKH
ERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGNGPYKCKECGKAFDCPSSFQIHERTH
TGEKPFECKQCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEK
PYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQCGKAFSFSSSFRMHERTHTGEKPYEC
KQCGKAFSCSSSFRMHERTHTGEKPYECKQCGKAFSCSSSIRIHERTHTGEKPYECKQCG
KAFSCSSSVRMHERTHTGEKPYECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFK
CSRSFRIHERVHSGE
Download sequence
Identical sequences A0A2K6BM61
XP_005588156.1.63531 XP_011716809.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]