SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011716876.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011716876.1.29376
Domain Number 1 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 245-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 304-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 13-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-21
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 595-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 516-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000533
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 104-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000151
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011716876.1.29376
Sequence length 654
Comment PREDICTED: zinc finger protein 709 isoform X3 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MQNLNCIHLSPGAQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENW
EEKNTEDHKNQGRKLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSMC
GKDYMCHSSLNRHMRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKP
YKCKQCGKAFSWPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCK
ECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGK
ALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFIS
LPSYRRHMIMHTGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPFECKQCGKAFSCSSSF
RMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHE
RIHTGEKPYECKQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHT
GEKPYECKQCGKAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGEKP
YECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences XP_011716876.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]