SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011717955.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011717955.1.29376
Domain Number 1 Region: 157-351
Classification Level Classification E-value
Superfamily E set domains 7.46e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-21
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011717955.1.29376
Sequence length 418
Comment PREDICTED: inward rectifier potassium channel 16 isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MSYYGSSYHIVNVDAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIALHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
GSCTSDTKARRRSFSAVAIVSSCENPEETTTSAAHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences A0A1D5RBD6 G7PV99
9544.ENSMMUP00000034136 XP_001083706.1.72884 XP_005584863.1.63531 XP_005584864.1.63531 XP_005584865.1.63531 XP_011717952.1.29376 XP_011717953.1.29376 XP_011717954.1.29376 XP_011717955.1.29376 XP_011717956.1.29376 XP_011845819.1.47321 XP_014975705.1.72884 XP_014975706.1.72884 XP_014975707.1.72884 XP_014975708.1.72884 XP_015294261.1.63531 XP_015294262.1.63531 ENSMMUP00000018469 ENSMMUP00000018469 ENSMMUP00000034136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]