SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011720056.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011720056.1.29376
Domain Number 1 Region: 1-260
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.37e-66
Family Glycogenin 0.00000000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011720056.1.29376
Sequence length 350
Comment PREDICTED: glycogenin-1 isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIM
VDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREEL
SAAPDPGWPDCFNSGVFVYQPSVETYNQLLRLASEQGSFDGGDQGILNTFFSSWATRDIR
KHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM
THPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAI
SHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Download sequence
Identical sequences A0A2K5NLR0 A0A2K5WZ67 A0A2K6BCY1 F7GFE5
XP_005546111.1.63531 XP_011720056.1.29376 XP_011919252.1.92194 XP_014987256.1.72884 9544.ENSMMUP00000007303 ENSMMUP00000007303 ENSMMUP00000007306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]