SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011733782.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011733782.1.29376
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 98-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000759
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011733782.1.29376
Sequence length 499
Comment PREDICTED: alpha-internexin [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSL
GLGLAYRRPPASEGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARAQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVAVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
PNPSYLLPPRILSSATSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEETTISSQKI
Download sequence
Identical sequences A0A096P6G7 A0A2K5N141 A0A2K5TNS1 A0A2K6DWL8 F7DY27
9544.ENSMMUP00000011635 ENSMMUP00000011635 ENSPANP00000020942 NP_001253499.1.72884 XP_005566388.1.63531 XP_011733782.1.29376 XP_011907093.1.92194 ENSMMUP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]