SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011737639.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011737639.1.29376
Domain Number 1 Region: 180-303
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.16e-59
Family Dystroglycan, domain 2 0.000000318
Further Details:      
 
Domain Number 2 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 8.95e-19
Family Dystroglycan, N-terminal domain 0.00000244
Further Details:      
 
Domain Number 3 Region: 496-596
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011737639.1.29376
Sequence length 894
Comment PREDICTED: dystroglycan isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MRMSVGLSLLLPLWGMAQILFSVAMAQSHWPSEPSEAVRDWDNQLEASMHSVLSDLHEAV
PTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDPQSHTLEGLP
LDTDKGVHYISVSAARLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTAFPDPGEVVSSA
CAVDEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIAN
KKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDP
VPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPT
TTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRIR
TTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLR
EQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQG
DRAPVRFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWTN
NTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSIAVMGSGSCRHLQFIPV
APPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKG
KLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTP
LNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences A0A2K5VM36 A0A2K6AMR3 F6RU72
ENSMMUP00000006224 9544.ENSMMUP00000006224 NP_001248280.1.72884 XP_005547188.1.63531 XP_005547189.1.63531 XP_005547190.1.63531 XP_005547191.1.63531 XP_005547192.1.63531 XP_005547193.1.63531 XP_005547194.1.63531 XP_011737639.1.29376 XP_011737640.1.29376 XP_011737641.1.29376 XP_011737642.1.29376 XP_011737643.1.29376 XP_014986293.1.72884 XP_014986295.1.72884 XP_014986296.1.72884 XP_014986297.1.72884 ENSMMUP00000006224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]