SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011737899.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011737899.1.29376
Domain Number 1 Region: 2039-2132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.95e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 339-477
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1303-1351,1432-1543
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1545-1698
Classification Level Classification E-value
Superfamily FAS1 domain 7.85e-26
Family FAS1 domain 0.0041
Further Details:      
 
Domain Number 5 Region: 795-951
Classification Level Classification E-value
Superfamily FAS1 domain 7.32e-22
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 6 Region: 216-329
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-21
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2130-2253,2288-2318
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000235
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 970-1061
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000017
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 9 Region: 1375-1412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011737899.1.29376
Sequence length 2426
Comment PREDICTED: stabilin-1 isoform X5 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MCNRGPRGDGSCLCFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCKCLPGYTQQGSE
CRVPNPCWPSPCSPLALCSVSPKGQAQCHCSENYHGDGIVCLPKDPCTDNLGGCPSNSTL
CVYQKPGQAFCTCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEV
GDGRACYGHLLHEVQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSS
RTMNASLAQQLCRQHIIAGQHILEDTRTQQTRKWWTLAGQEITVTFNQFTKYSYKYKDQP
QQTFNIYKANNIAANGVFHVVTGLRWQPPSGTPGDPKRTIGQILASTEAFSRFETILENC
GLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKL
ISKGRILTMANQVLAVNISEEGRILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPI
LPKHCSEEQHKIVAGSCVDCQALNTSMCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCAS
YCNQTVTEQGCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHI
CSNPNKHGDQCQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQ
HCHLHARCVSQEGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHC
TCHKGWSGDGRVCVAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPID
PCRAGNGGCHGLATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSIFYQWFK
SAGITLPADGRVTALVPSEAAVRQLNPEERAFWLQPRMLPSLVRAHFLQGALFEEELARL
GGQEVATLNPTTRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPSRGDVPGGQ
GLLQQLDLVPAFSLFRELLQRHRLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRH
HVVLGEALSMETLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGL
SGVLTVGSSRCLHSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSY
TCAKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEM
CELGRYGPNCTGVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNAN
CVQDSAGASICACAAGYSGNGVFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYM
GDGELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCREGYRGDGIRTCELLDPCSKNNG
GCSPYATCKSTGDGQRTCTCDTANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELK
GDGPFTIFVPHADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSG
HPLRFSEREGSIYLNDFARVVSSDHEAVNGILHFIDRVLLPPDALHWEPDDEPIPRRNVT
AAAQGFGYKIFSGLLKVASLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRD
KLAAILRGHMIRNVEALASDLPNLGPLRTMHGTPISFSCSRTRPGELMVGEDDARIVQRH
LPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACW
RLYPKFWTSPPLRSLGLHSVWVQHSLWARPQGLARGCHRNCVTTTWKPSCCPGHYGSECQ
ACPGGPSSPCSDRGMCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACRCTVHGRC
DEGLGGSGSCFCDEGWTGSRCEVQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRVC
TVADLCQDGHGGCSEHANCSQVGTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHAD
CLSTGLNTRRCECHAGYVGDGLQCLEELEPPVDRCLGRPPPCHSDAVCTDLHFQEKRAGV
FHLQATSGPYGLNFSEAEAACKAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSAAHPVV
FPVADCGNGRVGIVSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVL
AATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLEL
HASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVVSLAAVPPWWPWPLLTMGL
TLVSLQAPGTVVVSHVIVWDIVTFNGIIHALASPLLAPPQPQAVLAPKAPPVAAGVGAVL
AAGALLGLVAGAVYLRAQGKPTGFGFSAFQAEEDAADDFSPWQEGTNPTLVSVPNPVFGS
DTFCEPFHDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_011737899.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]