SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011738137.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011738137.1.29376
Domain Number 1 Region: 37-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.35e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000104
Further Details:      
 
Domain Number 2 Region: 392-520
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.47e-31
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011738137.1.29376
Sequence length 522
Comment PREDICTED: thioredoxin reductase 2, mitochondrial isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVIGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPHYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTVMIRSIPLRGFDQQMSSMVIEHMASHGTQFLRGCAPSRVRRLPDGHLQVTWEDCT
TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREGTSVPHIYAIGDV
VEGRPELTPTAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGC
Download sequence
Identical sequences 9544.ENSMMUP00000037287 ENSMMUP00000022553 ENSMMUP00000037287 XP_011738137.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]