SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011740926.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011740926.1.29376
Domain Number 1 Region: 45-241
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 2.09e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000114
Further Details:      
 
Domain Number 2 Region: 323-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 2.88e-64
Family C-terminal domain of adenylylcyclase associated protein 0.000000339
Further Details:      
 
Weak hits

Sequence:  XP_011740926.1.29376
Domain Number - Region: 235-271
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0115
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011740926.1.29376
Sequence length 477
Comment PREDICTED: adenylyl cyclase-associated protein 2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MANMQGLVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTF
RERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLR
HVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPPPP
PGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTR
SPTKSHTPSPTSPKSHPSQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCE
KSTLQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH
IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPVPEQFKTAWDGSKLITEPAEIMA
Download sequence
Identical sequences A0A2K5VWW9 A0A2K6CQZ7 H9FNR6
ENSMMUP00000002663 9544.ENSMMUP00000002663 ENSMMUP00000002663 NP_001253461.1.72884 XP_005554022.1.63531 XP_011740926.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]