SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011741129.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011741129.1.29376
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.67e-73
Family BAR domain 0.00000000052
Further Details:      
 
Domain Number 2 Region: 494-634
Classification Level Classification E-value
Superfamily PH domain-like 4.4e-26
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  XP_011741129.1.29376
Domain Number - Region: 621-667
Classification Level Classification E-value
Superfamily Gam-like 0.0353
Family Gam-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011741129.1.29376
Sequence length 709
Comment PREDICTED: DCC-interacting protein 13-alpha isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTN
PFGESGGIIKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRM
TESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLS
SVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIE
KDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA
Download sequence
Identical sequences A0A096MVI7 A0A0D9RK09 A0A2K5MZU1 A0A2K5UAG7 A0A2K6C620 H9EQ29
ENSPANP00000003866 XP_005547506.1.63531 XP_007982882.1.81039 XP_011741129.1.29376 XP_011914992.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]