SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011741688.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011741688.1.29376
Domain Number 1 Region: 100-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 156-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 61-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 225-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  XP_011741688.1.29376
Domain Number - Region: 273-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.029
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011741688.1.29376
Sequence length 317
Comment PREDICTED: zinc finger protein 771 isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPA
RPHACPDCGRAFARRSTLAKHARTHTGERPFACTECGRRFSQKSALTKHGRTHTGERPYE
CPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDC
GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF
GHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPP
GATAATATERCPECEGS
Download sequence
Identical sequences A0A2K5MQ47 A0A2K5QHL3 A0A2K5W204 A0A2K6CYY6 A0A2K6MSG3 F7BN91 F7HPT8 H2NQN4
ENSPPYP00000008219 ENSMMUP00000010969 9544.ENSMMUP00000010969 9600.ENSPPYP00000008219 ENSCJAP00000004728 ENSPPYP00000008219 XP_002756111.1.60252 XP_002826380.1.23681 XP_005591716.1.63531 XP_007988214.1.81039 XP_007988219.1.81039 XP_009007684.1.60252 XP_009007685.1.60252 XP_009248913.1.23681 XP_009248914.1.23681 XP_011741687.1.29376 XP_011741688.1.29376 XP_011741689.1.29376 XP_011944524.1.92194 XP_011944534.1.92194 XP_011944538.1.92194 XP_014981428.1.72884 XP_017370964.1.71028 XP_017370965.1.71028 XP_017370966.1.71028 XP_017736906.1.44346 XP_017736907.1.44346 XP_017736908.1.44346 XP_017736909.1.44346 ENSMMUP00000010969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]