SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011744287.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011744287.1.29376
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-66
Family Glutathione peroxidase-like 0.00000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011744287.1.29376
Sequence length 224
Comment PREDICTED: peroxiredoxin-6 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MPGGLLLGDEAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDKNRDLAILLGMLDPA
EKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD
WKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Download sequence
Identical sequences A0A096NR25 A0A0D9RH37 A0A2K5MH93 A0A2K5UQC3 A0A2K6ASN2 A0A2K6L1I2 A0A2K6R212 F7F6H0
ENSPANP00000015495 ENSMMUP00000011500 NP_001253014.1.72884 XP_010365666.1.97406 XP_011744287.1.29376 XP_011941302.1.92194 XP_017722406.1.44346 ENSMMUP00000011500 9544.ENSMMUP00000011500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]