SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011751969.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011751969.1.29376
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-46
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011751969.1.29376
Sequence length 210
Comment PREDICTED: regulator of G-protein signaling 17 isoform X4 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
Download sequence
Identical sequences A0A096NYS7 A0A2K6D5X6 A0A2K6LK32 A0A2K6Q4L8 A0A2K6RYS0 F6QJW7 F7ISK0 G1RZT6 G3RNN8 G7P4X8 H2PKP0 H2R6V7 Q9UGC6
ENSCJAP00000023427 NP_001270615.1.63531 NP_036551.3.87134 NP_036551.3.92137 XP_002747166.1.60252 XP_002817547.1.23681 XP_003255951.1.23891 XP_003811535.1.60992 XP_003933798.1.74449 XP_004044899.1.27298 XP_009240658.1.23681 XP_010356486.1.97406 XP_011751969.1.29376 XP_014992588.1.72884 XP_016811989.1.37143 XP_017727182.1.44346 ENSNLEP00000018763 ENSPANP00000018242 ENSP00000206262 ENSPTRP00000049525 ENSP00000206262 ENSP00000356194 ENSPPYP00000019168 ENSPTRP00000049525 ENSNLEP00000018763 ENSP00000206262 ENSP00000356194 gi|21361405|ref|NP_036551.3| 9598.ENSPTRP00000049525 9600.ENSPPYP00000019168 9606.ENSP00000206262 ENSPPYP00000019168 ENSCJAP00000023427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]