SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011752318.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011752318.1.29376
Domain Number 1 Region: 217-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-70
Family Nuclear receptor ligand-binding domain 0.000000000653
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011752318.1.29376
Sequence length 468
Comment PREDICTED: nuclear receptor ROR-alpha isoform X3 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MMYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNC
LIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQ
PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLD
INGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREEL
QQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVL
LKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDIFKSLGCEDFISFVFEFGKSLCSMHL
TEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVS
TLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences A0A096NM90 A0A2K5NLT4 A0A2K5VE87
XP_008014580.1.81039 XP_011752318.1.29376 XP_011948289.1.92194 ENSPANP00000014100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]