SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011753365.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011753365.1.29376
Domain Number 1 Region: 282-334
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000239
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  XP_011753365.1.29376
Domain Number - Region: 383-426
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0143
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011753365.1.29376
Sequence length 711
Comment PREDICTED: metastasis-associated protein MTA1 isoform X6 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHAT
LSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRG
KCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEG
EEDGRDQSKLETKVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAA
ASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYG
KDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNP
NQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYW
KKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARR
LCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETH
PRPPKPDPVKSVSSVLSSLTPAKAAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSR
GLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEE
TRKIRKLLSSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED
Download sequence
Identical sequences XP_011753365.1.29376 ENSPANP00000013386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]