SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011755124.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011755124.1.29376
Domain Number 1 Region: 81-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.55e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000723
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011755124.1.29376
Sequence length 222
Comment PREDICTED: glutathione S-transferase A3 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIESAEDLEKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKNRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISSFPL
LKALKTRISNMPTVKKFLQPGSPRKPPPDAKALEEARKIFRF
Download sequence
Identical sequences A0A023JCA5 A0A2K6CZ85 F7H2T0
ENSMMUP00000033535 NP_001248197.1.72884 NP_001276889.1.63531 XP_011755124.1.29376 ENSMMUP00000022540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]