SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011757228.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011757228.1.29376
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000926
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000285
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 287-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  XP_011757228.1.29376
Domain Number - Region: 252-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0541
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011757228.1.29376
Sequence length 685
Comment PREDICTED: delta-like protein 4 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MAAASWSASGWALLLLVALWQQRAAGSGVFQLQLQEFVNERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGASYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCERHVSDCARNPCAHGGTCHDLESGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences A0A096NTJ5 A0A2K5MVD4 A0A2K5W2Z5 A0A2K6D704 F7G756
9544.ENSMMUP00000019092 XP_001099250.1.72884 XP_005559283.1.63531 XP_011757228.1.29376 XP_011890207.1.92194 ENSMMUP00000019092 ENSMMUP00000019092 ENSPANP00000016366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]