SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011757285.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011757285.1.29376
Domain Number 1 Region: 258-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-84
Family Protein kinases, catalytic subunit 0.000000000606
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011757285.1.29376
Sequence length 537
Comment PREDICTED: tyrosine-protein kinase Fyn isoform X1 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences A0A096NW74 A0A0D9RST7 A0A2I3HC72 A0A2I3SKP4 A0A2J8U1C4 A0A2K5IMW1 A0A2K5MDU1 A0A2K5YJ25 A0A2K6B9D1 A0A2K6K4W3 A0A2K6PQK4 F7FVL2 G1TA73 G3QYF5 G7P3M8 P06241
ENSP00000229471 NP_002028.1.87134 NP_002028.1.92137 XP_001159342.1.37143 XP_002714971.1.1745 XP_003255626.1.23891 XP_005551664.1.63531 XP_005551665.1.63531 XP_008005496.1.81039 XP_008005497.1.81039 XP_008005498.1.81039 XP_008005499.1.81039 XP_008005500.1.81039 XP_008005501.1.81039 XP_008261604.1.1745 XP_008974002.1.60992 XP_008974003.1.60992 XP_010369949.1.97406 XP_010369950.1.97406 XP_011757285.1.29376 XP_011757286.1.29376 XP_011757287.1.29376 XP_011757288.1.29376 XP_011757289.1.29376 XP_011790412.1.43180 XP_011826001.1.47321 XP_011905913.1.92194 XP_011905914.1.92194 XP_011905915.1.92194 XP_014993050.1.72884 XP_014993051.1.72884 XP_015303887.1.63531 XP_016811669.1.37143 XP_016811670.1.37143 XP_016811671.1.37143 XP_016811672.1.37143 XP_016811673.1.37143 XP_016866139.1.92137 XP_016866140.1.92137 XP_016866141.1.92137 XP_016866142.1.92137 XP_016866143.1.92137 XP_017702620.1.44346 XP_017702621.1.44346 XP_017702622.1.44346 XP_018885259.1.27298 ENSPANP00000017299 ENSP00000346671 ENSP00000357656 ENSPTRP00000031615 ENSNLEP00000015723 ENSOCUP00000013559 ENSOCUP00000013559 FYN HR3165 ENSP00000346671 ENSP00000357656 gi|4503823|ref|NP_002028.1| ENSPTRP00000031615 9598.ENSPTRP00000031615 9606.ENSP00000357656 9986.ENSOCUP00000013559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]