SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011763096.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011763096.1.29376
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-41
Family Galectin (animal S-lectin) 0.0000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011763096.1.29376
Sequence length 139
Comment PREDICTED: placental protein 13-like isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MSSLPVPYTLPVSLSVGSCVIITGTPILTFVKDPQLEVNFYTGTDEDSDIAFQFRLHFGH
PAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPAS
VKMLQVLRDISLTRVLISD
Download sequence
Identical sequences A0A2K5WQP0 A0A2K5Z6D5 A0A2K6DCJ7 C5HZ20 F6YWA7
ENSMMUP00000005668 ENSMMUP00000005668 9544.ENSMMUP00000005668 XP_011763096.1.29376 XP_011828783.1.47321 ENSPANP00000004725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]