SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011769341.1.29376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011769341.1.29376
Domain Number 1 Region: 218-362
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-38
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-31
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011769341.1.29376
Sequence length 597
Comment PREDICTED: FERM domain-containing protein 3 isoform X2 [Macaca nemestrina]; AA=GCF_000956065.1; RF=representative genome; TAX=9545; STAX=9545; NAME=Macaca nemestrina; AL=Scaffold; RT=Major
Sequence
MFASCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANI
SQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEDNISAPLISSSPVKA
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLL
FVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS
Download sequence
Identical sequences A0A1D5QEI6 A0A2K6DKK9 A0A2K6RXX8 G7PSL4
ENSMMUP00000022603 ENSMMUP00000022605 9544.ENSMMUP00000022603 XP_002800197.1.72884 XP_005582068.1.63531 XP_007967775.1.81039 XP_010382334.1.97406 XP_011769341.1.29376 XP_017727855.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]