SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011784147.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011784147.1.43180
Domain Number 1 Region: 129-209
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 40-106
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 411-459
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000119
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011784147.1.43180
Sequence length 464
Comment PREDICTED: RNA-binding E3 ubiquitin-protein ligase MEX3C isoform X1 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MMAAMLSHAYGPGGCGAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKI
KALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALG
GLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTG
MPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSR
ARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVD
SPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHP
LARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENE
VIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences B3KTW5
9544.ENSMMUP00000031136 XP_003926111.1.74449 XP_005586731.1.63531 XP_008529039.1.77740 XP_010375090.1.97406 XP_011784147.1.43180 XP_011784148.1.43180 ENSMMUP00000031136 ENSMMUP00000031136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]