SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011786810.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011786810.1.43180
Domain Number 1 Region: 56-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.35e-53
Family Phosducin 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011786810.1.43180
Sequence length 301
Comment PREDICTED: phosducin-like protein [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDPGRGAPASSSVPAEAELAGEGISVNTGPK
GVINDWRRFKQLETEQKEEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMT
LKEFAMMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKS
IVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCRVKSSVIGASSRFTRNALPALLIYK
GGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEI
D
Download sequence
Identical sequences A0A0D9RLS8 A0A2I3LQA2 A0A2K5K3J4 A0A2K5MBG5 A0A2K5Y8G6 A0A2K6CK64 F7F3M0 G7PRH7
NP_001244595.1.72884 XP_005580898.1.63531 XP_005580899.1.63531 XP_008004542.1.81039 XP_008004544.1.81039 XP_011709586.1.29376 XP_011786810.1.43180 XP_011820876.1.47321 XP_011894656.1.92194 XP_011894657.1.92194 XP_014972344.1.72884 ENSMMUP00000009054 9544.ENSMMUP00000009054 ENSPANP00000018906 ENSMMUP00000009054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]