SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011786921.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011786921.1.43180
Domain Number 1 Region: 12-148,177-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.2e-82
Family Protein kinases, catalytic subunit 0.00000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011786921.1.43180
Sequence length 365
Comment PREDICTED: casein kinase I isoform alpha isoform X1 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
Download sequence
Identical sequences A0A0P6J739 A0A1S3W323 A0A250YGG9 A0A286X950 A0A2I3HMA6 A0A2I3NG04 A0A2J8X5X2 A0A2K5CCU1 A0A2K5SAE3 A0A2K5UU67 A0A2K6CPS0 A0A2K6TCE9 F1PUU0 F7HFK8 G3RDH8 H9ENA3 K7CWA0 M3WUY5 M3YS36
ENSP00000421268 ENSCJAP00000039337 ENSNLEP00000012414 ENSCAFP00000027016 ENSCJAP00000039334 ENSMPUP00000014146 9598.ENSPTRP00000047919 9606.ENSP00000261798 ENSGGOP00000013583 ENSPTRP00000047919 ENSCAFP00000027019 gi|68303575|ref|NP_001020276.1| ENSGGOP00000013583 ENSMPUP00000014146 ENSP00000421689 ENSNLEP00000012414 ENSP00000421689 ENSPTRP00000047919 NP_001020276.1.87134 NP_001020276.1.92137 XP_001163959.1.37143 XP_001917775.2.31192 XP_002744402.1.60252 XP_003266674.1.23891 XP_003404640.2.64505 XP_003829089.1.60992 XP_003981454.2.62641 XP_004384965.1.4749 XP_004587605.1.84141 XP_004664818.1.11716 XP_004686929.1.23501 XP_004696772.1.18182 XP_004737915.1.14098 XP_004854449.1.39548 XP_005209608.1.76553 XP_005324233.1.77405 XP_005380659.1.28644 XP_005558278.1.63531 XP_005619366.1.84170 XP_005661856.1.46622 XP_005683209.1.57651 XP_005870519.2.60319 XP_006150935.1.99106 XP_006175975.1.101512 XP_006906446.2.64745 XP_007093430.1.5354 XP_007188739.1.59432 XP_007447558.1.90284 XP_008013130.1.81039 XP_008150412.1.99482 XP_008253077.1.1745 XP_008526534.1.77740 XP_008579132.1.73410 XP_008690746.1.72690 XP_008836126.1.79516 XP_010342830.1.74449 XP_010385164.1.97406 XP_010625443.1.5607 XP_010848835.1.44457 XP_010954392.1.22495 XP_010987783.1.51371 XP_011221852.1.58354 XP_011369437.1.92234 XP_011714339.1.29376 XP_011786921.1.43180 XP_011840770.1.47321 XP_011924122.1.92194 XP_011968752.1.54773 XP_012034170.1.66739 XP_012308785.1.9421 XP_012360364.1.23891 XP_012370208.1.9945 XP_012597023.1.48125 XP_012996481.1.53824 XP_014708085.1.49734 XP_014939060.1.86478 XP_014996662.1.72884 XP_015341522.1.40921 XP_016005836.1.101085 XP_016040780.1.11023 XP_017386815.1.71028 XP_017512117.1.32401 XP_017731300.1.44346 XP_018883041.1.27298 XP_019319927.1.44245 XP_019479958.1.44202 XP_019589891.1.88060 XP_019820774.1.53367 XP_020025586.1.5219 XP_020759078.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]