SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011800617.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011800617.1.43180
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000209
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011800617.1.43180
Sequence length 162
Comment PREDICTED: protransforming growth factor alpha isoform X4 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGCRFY
Download sequence
Identical sequences G7PMF3
ENSMMUP00000013878 XP_011800617.1.43180 9544.ENSMMUP00000013878 ENSMMUP00000013878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]