SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011812579.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011812579.1.43180
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.94e-34
Family Dual specificity phosphatase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011812579.1.43180
Sequence length 150
Comment PREDICTED: dual specificity protein phosphatase 23 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Download sequence
Identical sequences A0A0D9S3Z3 A0A140VJI5 A0A2K5K242 A0A2K5MZU7 A0A2K5PT31 A0A2K5VHQ5 A0A2K6DU61 A0A2K6K8F0 A0A2K6QF60 A0A2K6TX31 F7HEX0 H2N568 H2Q0D2 Q9BVJ7
ENSMMUP00000024264 ENSMMUP00000038614 NP_001306587.1.87134 NP_001306587.1.92137 NP_001306588.1.87134 NP_001306588.1.92137 NP_060293.2.87134 NP_060293.2.92137 XP_001170819.1.37143 XP_002809981.1.23681 XP_003811960.1.60992 XP_005541367.1.63531 XP_007974751.1.81039 XP_008962552.1.60992 XP_009433657.1.37143 XP_010346830.1.74449 XP_010359091.1.97406 XP_011768323.1.29376 XP_011812579.1.43180 XP_011812580.1.43180 XP_011825811.1.47321 XP_011825812.1.47321 XP_011923088.1.92194 XP_014968308.1.72884 XP_017359163.1.71028 XP_017720392.1.44346 gi|56786144|ref|NP_060293.2| ENSPTRP00000002575 ENSPPYP00000000763 ENSPTRP00000002575 ENSP00000357087 ENSP00000357088 ENSP00000357089 ENSGGOP00000014597 NYSGXRC-8673a ENSP00000357087 9544.ENSMMUP00000024264 9598.ENSPTRP00000002575 9600.ENSPPYP00000000763 9606.ENSP00000357087 ENSGGOP00000014597 4erc_A 4erc_B ENSMMUP00000024264 ENSPPYP00000000763 ENSP00000357087 ENSP00000357088 ENSP00000357089 000154484|e4ercA1|2007.2.3.2|A:1-150 000990755|e4ercB1|2007.2.3.2|B:1-150 cath|current|4ercA00/1-150 cath|current|4ercB00/1-150 ENSPANP00000012290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]