SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011814250.1.43180 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011814250.1.43180
Domain Number 1 Region: 2206-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-32
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1470-1518,1599-1710
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1712-1865
Classification Level Classification E-value
Superfamily FAS1 domain 9.16e-26
Family FAS1 domain 0.0041
Further Details:      
 
Domain Number 5 Region: 962-1119
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-21
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 6 Region: 383-496
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-21
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-17
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1137-1228
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000209
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011814250.1.43180
Sequence length 2568
Comment PREDICTED: stabilin-1 [Colobus angolensis palliatus]; AA=GCF_000951035.1; RF=representative genome; TAX=336983; STAX=54131; NAME=Colobus angolensis palliatus; AL=Scaffold; RT=Major
Sequence
MAGPQGLLPLCLLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGSCL
CFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSPCS
PLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLVSINNNASAGCFPFCSPFSCDRSATCKATADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQAGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANNIA
ANGVFHVVTGLRWQPPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFT
VFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQV
LAVNISEEGRILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIV
AGSCVDCQALNTSTCPRNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCK
GFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQE
DCGCVHGLCDNRPGSGGVCQQGTCAPGFSGQFCNESMGDCGPTGLAQHCHLHARCVSQEG
VARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRIC
VAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLA
TCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAHFSVFYQWFKSAGITLPADRQVT
ALVPSEAAIRQLNPEERAFWLQPRMLPSLVRAHFLQGALFEEELARLGGQEVATLNPTTR
WEIRNISGRVWVQNASVDVADLLATNGVLHILGQVLLPPRGDVPGGQGLLQQLDLVPAFS
LFRELLQRHRLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVILGEALSMETL
RKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCLH
SHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCTGV
CDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKVTSPQCLRKCDPNANCVQDSAGASTCAC
AAGYSGNGVFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCL
IHHGGCHIHAECIPTGPQQVSCSCRQGYSGDGIRTCELLDPCSKNNGGCSPYATCKSTGD
GQRTCTCDTANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHAD
LMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIY
LNDFARVVSSDHEAVNGILHFIDHVLLPPDALHWEPDDEPIPRRNVTAAAQGFGYKIFSG
LLKVASLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMIRN
VEALASDLPNLGPLRTMHGTPISFSCSRMRPGELMVGEDDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPPLR
SLGLRSVWIQHSLWARPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSDR
GMCMDGMSGSGQCLCHSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCFCD
EGWTGSHCEVQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHGGC
SEHANCSQVGTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTRRCEC
HAGYVGDGLQCLEELEPPVDRCLGRPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGLN
FSEAEAACKAQGAVLASLPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPVADCGNGRVGI
VSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGML
LGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANAS
QGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRVIVWDIMAFNGIIHALASPLLAP
PQPQAVLAPAAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPTGFGFSAFQAEEDAADD
FSPWQEGTNPTLVSVPNPVFGSDTFCEPFNDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences A0A2K5HP51
XP_011814250.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]