SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011822027.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011822027.1.47321
Domain Number 1 Region: 259-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-64
Family Nuclear receptor ligand-binding domain 0.000000000877
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011822027.1.47321
Sequence length 486
Comment PREDICTED: bile acid receptor isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MVMQFQELENPIQISPHCSCTPSGFFTEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAESLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTMNEDSQG
RDLRQVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQKMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences A0A2K5XS38 A0A2K6BCT3 G7PJA3
XP_005572045.1.63531 XP_011760098.1.29376 XP_011822027.1.47321 XP_011888130.1.92194 XP_015008048.1.72884 ENSMMUP00000038826 9544.ENSMMUP00000038826 ENSMMUP00000038826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]