SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011824947.1.47321 from NCBI 2017_08 genome

(show help)
Strong hits

Sequence:	XP_011824947.1.47321
Domain Number 1	Region: 129-191
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.83e-18
Family	LIM domain	0.0012
Further Details:

Domain Number 2	Region: 188-254
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	1.14e-17
Family	LIM domain	0.0011
Further Details:

Domain Number 3	Region: 68-132
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000103
Family	LIM domain	0.0029
Further Details:

Domain Number 4	Region: 7-71
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000171
Family	LIM domain	0.019
Further Details:

Domain Number 5	Region: 250-278
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000134
Family	LIM domain	0.0012
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	XP_011824947.1.47321
Sequence length	279
Comment	PREDICTED: four and a half LIM domains protein 2 isoform X3 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence	MTERFDCHHCNESLFGKKYILREESPYCVACFETLFANTCEECGKPIGCDCKDLSYKDRH WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences	A0A0D9RWX3 A0A2K5HTS7 F7GXH4 G7PMV9 ENSMMUP00000021812 ENSMMUP00000021815 ENSMMUP00000021816 ENSMMUP00000036195 ENSPANP00000003788 9544.ENSMMUP00000021816 XP_001109039.1.72884 XP_005575239.1.63531 XP_008006477.1.81039 XP_008006478.1.81039 XP_008006479.1.81039 XP_010359284.1.97406 XP_010359285.1.97406 XP_011753830.1.29376 XP_011812015.1.43180 XP_011812016.1.43180 XP_011812017.1.43180 XP_011824944.1.47321 XP_011824946.1.47321 XP_011824947.1.47321 XP_011824948.1.47321 XP_011910872.1.92194 XP_011910874.1.92194 XP_011910875.1.92194 XP_014968530.1.72884 XP_017730527.1.44346 XP_017730528.1.44346 ENSMMUP00000021809

SEARCH