SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011828684.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011828684.1.47321
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000158
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011828684.1.47321
Sequence length 695
Comment PREDICTED: zinc finger protein 607 isoform X2 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MACESITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLGHFISKPDLITLLEQ
GKEPWMIVGEETRGECTDLDSRCEIISDGKMHLYRKQSSVTLHQRIHNGQKPYECKECQK
AFSHLTELIVHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAREKPYECEECGKVFSY
PANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLTAPHTFESV
AKPYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKPY
KCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGKS
FRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHA
SHLIIHERIHTSDKPYECKRCGKAFRCASYLVRHERVHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences A0A2K5Z2S2
XP_011828684.1.47321 XP_011828686.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]