SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011829187.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011829187.1.47321
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.55e-32
Family APC10-like 0.0000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011829187.1.47321
Sequence length 144
Comment PREDICTED: intraflagellar transport protein 25 homolog isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIE
RLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIMARDGSATYLRFIIV
SAFDHFASVHSVSAEGTVVSNLSS
Download sequence
Identical sequences A0A2I3LMD6 A0A2K5ZQV0 A0A2K6BZP2 F7CMZ0 G7NVQ7
ENSMMUP00000001898 ENSPANP00000009058 NP_001244683.1.72884 XP_005543361.1.63531 XP_005543362.1.63531 XP_005543364.1.63531 XP_005543365.1.63531 XP_005543366.1.63531 XP_005543367.1.63531 XP_005543368.1.63531 XP_007976860.1.81039 XP_007976861.1.81039 XP_007976862.1.81039 XP_007976863.1.81039 XP_007976864.1.81039 XP_007976865.1.81039 XP_007976866.1.81039 XP_007976867.1.81039 XP_007976869.1.81039 XP_007976870.1.81039 XP_011762585.1.29376 XP_011762587.1.29376 XP_011762588.1.29376 XP_011762589.1.29376 XP_011762590.1.29376 XP_011762591.1.29376 XP_011762592.1.29376 XP_011829187.1.47321 XP_014994974.1.72884 XP_014994976.1.72884 XP_014994986.1.72884 XP_014994995.1.72884 XP_014995000.1.72884 XP_014995005.1.72884 XP_014995009.1.72884 XP_015291093.1.63531 9544.ENSMMUP00000001899 ENSMMUP00000001899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]