SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011832665.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011832665.1.47321
Domain Number 1 Region: 104-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-17
Family LIM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000416
Family LIM domain 0.00072
Further Details:      
 
Domain Number 3 Region: 146-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000235
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000155
Family LIM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011832665.1.47321
Sequence length 194
Comment PREDICTED: cysteine and glycine-rich protein 3 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTHQVEKKE
Download sequence
Identical sequences A0A0D9QYH0 A0A2K5IMU1 A0A2K5YI66 A0A2K6C5P4 A0A2K6L0R0 A0A2K6NPN6 F6T7Q2 F6V0P8 G7PQK4
ENSMMUP00000025138 9544.ENSMMUP00000025138 9796.ENSECAP00000013771 ENSPANP00000002308 XP_001095430.1.72884 XP_001505029.1.31192 XP_005578472.1.63531 XP_005578473.1.63531 XP_008002679.1.81039 XP_008528745.1.77740 XP_010386428.1.97406 XP_011748538.1.29376 XP_011792871.1.43180 XP_011832662.1.47321 XP_011832665.1.47321 XP_011943961.1.92194 XP_011943962.1.92194 XP_011943963.1.92194 XP_014970137.1.72884 XP_017713712.1.44346 ENSECAP00000013771 ENSMMUP00000025138 ENSECAP00000013771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]