SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011832823.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011832823.1.47321
Domain Number 1 Region: 104-283
Classification Level Classification E-value
Superfamily EF-hand 7.15e-51
Family Calmodulin-like 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011832823.1.47321
Sequence length 285
Comment PREDICTED: Kv channel-interacting protein 2 isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRV
FRFLGDSSLPSALAAPASLRPHRPRLLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDF
VAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
REHVENFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A096P6C9 A0A0D9QZL3 A0A2K5HDL6 A0A2K5MU44 A0A2K5ZYJ1 A0A2K6C6F7 G7PDT7
XP_001111523.1.72884 XP_005566315.1.63531 XP_007962128.1.81039 XP_011733866.1.29376 XP_011790887.1.43180 XP_011832823.1.47321 XP_011906996.1.92194 ENSPANP00000020904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]