SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011838719.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011838719.1.47321
Domain Number 1 Region: 80-222
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-34
Family C-type lectin domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011838719.1.47321
Sequence length 229
Comment PREDICTED: C-type lectin domain family 1 member B isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MQDEDGYVTLNIKTRKPALISVDPASSSWWRVMALILLILCVGMVVGLVALGIWSVMQHN
YLQDENENRTGTLQQLAKRFCQYVIKQSELKGTFKGHKCSPCDTNWRYYGDNCYGFFKHN
LTWKESKQYCTDLNATLLKIDNHNILEYIKARTGLIRWVGLSRQKSNEVWKWEDGSVLSE
NMFELLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP
Download sequence
Identical sequences A0A2K5WEU9 A0A2K6AJ42 A0A2K6E0U7 F7GZT6
XP_001114790.1.72884 XP_005570157.1.63531 XP_011771090.1.29376 XP_011838719.1.47321 ENSMMUP00000003949 9544.ENSMMUP00000003949 ENSMMUP00000003948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]