SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011842822.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011842822.1.47321
Domain Number 1 Region: 231-322
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.83e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 100-272
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011842822.1.47321
Sequence length 418
Comment PREDICTED: small conductance calcium-activated potassium channel protein 3 isoform X5 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVC
AIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDAS
SRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSN
FLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEK
HVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRS
VKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSL
PLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences A0A2J8Q343 A0A2J8VG18
XP_010362984.1.97406 XP_011842822.1.47321 XP_011932125.1.92194 XP_015312095.1.63531 XP_017723188.1.44346 XP_018878770.1.27298 ENSP00000351295 ENSP00000351295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]