SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011843458.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011843458.1.47321
Domain Number 1 Region: 186-460
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.26e-79
Family Mitochondrial carrier 0.0000648
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily EF-hand 7.5e-28
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011843458.1.47321
Sequence length 469
Comment PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2 isoform X5 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD
KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE
KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE
RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGAR
SLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP
MEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETL
KNAWLQRYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS
SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences A0A2J8UK22 A0A2K5JM84 A0A2K5XXB5 A0A2K6KLS9 A0A2K6RWH1
ENSGGOP00000018846 ENSGGOP00000018846 XP_002820294.1.23681 XP_004048717.1.27298 XP_008004294.1.81039 XP_010366113.1.97406 XP_011786695.1.43180 XP_011843458.1.47321 XP_011894421.1.92194 XP_017703724.1.44346 ENSNLEP00000021270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]