SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011845648.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011845648.1.47321
Domain Number 1 Region: 346-604
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-40
Family Kelch motif 0.00088
Further Details:      
 
Domain Number 2 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 1.53e-32
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011845648.1.47321
Sequence length 685
Comment PREDICTED: kelch repeat and BTB domain-containing protein 7 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFA
DAFDHHKLRSQAQSYIAQNFKQLSRMGSIREETLADLTLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQ
MRYGDLLYKSLVPVPNSSSSSSSSSNSLVSAAENPPQRLGMCAKEMVIFFGHPRDPFLCY
DPYSGDIYTMPSPLTSFAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLA
DRLLCREGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFEL
IVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNP
ARGEWRRISNIPLDSETHNYQIVNHDRKLLLITSTTPQWKKNRVTVYEYDTREDQWINIG
TMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSS
SSFSDDEVWVQVAPQRNAQDQQGSL
Download sequence
Identical sequences A0A2K5UKQ7 A0A2K5XNH4 A0A2K6AXM5 F6S776
9544.ENSMMUP00000006378 ENSMMUP00000006378 XP_005585782.1.63531 XP_011756695.1.29376 XP_011845648.1.47321 XP_014976454.1.72884 ENSMMUP00000006378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]