SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011848685.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011848685.1.47321
Domain Number 1 Region: 28-57,175-344
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.47e-59
Family G proteins 0.0000000227
Further Details:      
 
Domain Number 2 Region: 57-177
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 9.29e-42
Family Transducin (alpha subunit), insertion domain 0.000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011848685.1.47321
Sequence length 350
Comment PREDICTED: guanine nucleotide-binding protein G(t) subunit alpha-1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLE
ECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMS
DIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGI
IETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMH
ESLHLFNSICNHRYFATTSIVLFLNKKDVFFEKIKKAHLSICFPDYDGPNTYEDAGNYIK
VQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences A0A024R2Z1 A0A0D9RPE2 A0A2J8TGW1 A0A2K5DP25 A0A2K5HCK0 A0A2K5P5U8 A0A2K6AKH4 A0A2K6EB03 A0A2K6MEE5 A0A2K6P015 G3QZZ3 G7ML75 G7NXT3 H2QMN3 P11488
ENSGGOP00000008466 ENSPTRP00000025800 ENSMMUP00000013546 ENSP00000232461 ENSP00000387555 gi|22027520|ref|NP_000163.2| gi|22027522|ref|NP_653082.1| ENSP00000232461 ENSP00000387555 ENSMMUP00000013546 9544.ENSMMUP00000013546 9598.ENSPTRP00000025800 9600.ENSPPYP00000015501 9606.ENSP00000232461 ENSPTRP00000025800 ENSGGOP00000008466 ENSPANP00000001447 NP_000163.2.87134 NP_000163.2.92137 NP_653082.1.87134 NP_653082.1.92137 XP_001167971.1.37143 XP_003776289.1.23681 XP_003776290.1.23681 XP_003818884.1.60992 XP_003818885.1.60992 XP_004034222.1.27298 XP_004034223.1.27298 XP_005547235.1.63531 XP_005547236.1.63531 XP_007950176.1.48129 XP_007982486.1.81039 XP_010367649.1.97406 XP_010367658.1.97406 XP_011737700.1.29376 XP_011737701.1.29376 XP_011794437.1.43180 XP_011794438.1.43180 XP_011848684.1.47321 XP_011848685.1.47321 XP_011889165.1.92194 XP_011889166.1.92194 XP_012323210.1.9421 XP_012323211.1.9421 XP_014986355.1.72884 XP_014986356.1.72884 XP_017723511.1.44346 XP_017723512.1.44346 ENSP00000232461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]