SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011854706.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011854706.1.47321
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-24
Family Canonical RBD 0.00024
Further Details:      
 
Domain Number 2 Region: 396-479
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 276-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 192-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 484-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011854706.1.47321
Sequence length 577
Comment PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 isoform X1 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Download sequence
Identical sequences A0A096P447 A0A0D9S3X2 A0A1U7TPA6 A0A2I2Z4W1 A0A2K5CKL6 A0A2K5INE7 A0A2K5NKH1 A0A2K5TUQ5 A0A2K5XSC4 A0A2K6C8Q7 A0A2K6LJJ5 A0A2K6QSR6 F6X5X9 G1QR76 G7NHE3 H2NVK1 Q9NZI8
NP_006537.3.87134 NP_006537.3.92137 XP_002748506.1.60252 XP_002834307.1.23681 XP_003278798.1.23891 XP_003503989.1.69978 XP_005350687.1.66349 XP_005583649.1.63531 XP_007631097.1.28591 XP_008011230.1.81039 XP_008061844.1.4292 XP_008567119.1.73410 XP_008836519.1.79516 XP_010358101.1.97406 XP_011723782.1.29376 XP_011815284.1.43180 XP_011854706.1.47321 XP_011901628.1.92194 XP_012307244.1.9421 XP_017709413.1.44346 XP_018883870.1.27298 ENSPPYP00000010002 ENSCJAP00000013583 ENSP00000290341 ENSP00000290341 ENSNLEP00000003444 ENSPANP00000020122 ENSNLEP00000003444 ENSPPYP00000010002 ENSP00000290341 ENSCJAP00000013579 gi|56237027|ref|NP_006537.3| 9600.ENSPPYP00000010002 9606.ENSP00000290341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]