SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011857276.1.47321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011857276.1.47321
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-74
Family Glutathione peroxidase-like 0.0000000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011857276.1.47321
Sequence length 199
Comment PREDICTED: peroxiredoxin-1 isoform X3 [Mandrillus leucophaeus]; AA=GCF_000951045.1; RF=representative genome; TAX=9568; STAX=9568; NAME=Mandrillus leucophaeus; AL=Scaffold; RT=Major
Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
Download sequence
Identical sequences A0A096NP25 A0A2K5NSU6 A0A2K6AAW1 A0A2K6D8Z2 A0A2K6KC01 A0A2K6RDT0 G7MGP8 G7NV01 H2N7K9
9544.ENSMMUP00000008176 9600.ENSPPYP00000001637 ENSPPYP00000001637 ENSPANP00000014742 ENSPPYP00000001637 NP_001247862.1.72884 XP_002810940.1.23681 XP_008149426.1.99482 XP_010361363.1.97406 XP_011762297.1.29376 XP_011762298.1.29376 XP_011857276.1.47321 XP_011857278.1.47321 XP_011857279.1.47321 XP_011857280.1.47321 XP_011934305.1.92194 XP_015306963.1.63531 XP_017737282.1.44346 XP_017737283.1.44346 ENSMMUP00000008176 ENSMMUP00000008176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]