SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011875875.1.68811 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011875875.1.68811
Domain Number 1 Region: 96-548
Classification Level Classification E-value
Superfamily Sema domain 1.31e-120
Family Sema domain 0.0000845
Further Details:      
 
Domain Number 2 Region: 1434-1558,1816-2000
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.02e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 898-988
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000238
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 1077-1148
Classification Level Classification E-value
Superfamily E set domains 0.00000000000102
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000249
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 991-1068
Classification Level Classification E-value
Superfamily E set domains 0.00000000196
Family Other IPT/TIG domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011875875.1.68811
Sequence length 2036
Comment PREDICTED: plexin-B isoform X2 [Vollenhovia emeryi]; AA=GCF_000949405.1; RF=representative genome; TAX=411798; STAX=411798; NAME=Vollenhovia emeryi; AL=Scaffold; RT=Major
Sequence
MRFLGLAQSFPRSPTVTPLQVPLPPLLHRSSLSSMSVATWFLVILATAAIDTPASTAPPV
QDNRSPHVITQFPAGNGQRYGHLALSANATREGALRFNHLAIDPASGRLYGGAVNRLFQL
DSNLKLEEYVSTGPRLDSPQCPAKDCSTRDISLSLMDNVNKLLISGLESQMLIVCGSLRQ
GSCEIYQMSNISIAPKFFPKGVAANDESSSTYAFIGPEKYNPWGHTNILYVGTTFTNNGD
YRHDVPAISSRNLDNMQFVESSFNKHSSVNIDVKYRDHFLIKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCMVDLGDGKQHNYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFSPCRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFITSVTI
ANTESHTVAFFGTNDGVLKKVLLSGAEAFVYESVTIDKGQKLLPDTLISPDGEYIYVLST
SKISKVKVEHCSGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCRT
PPVAERSSIPEGTDHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCIHNTSCQGIISGENNQAHLAAHGAQFCPRFVERKEPLMLPNSVPKEIVLEVDNL
PHPQVGHSGFQCIVSIEGANLKVQARVDSNRYIVCDKTVYSYEAVSGEYEAEVTVVWNTN
HHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFTECPK
PRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCILVDYEVSVRIVCRTG
RHEPTDAASVVVGNDAGYTESAVLFNYKDIVLSGVHPSVGPQSGGTQLAITGKYLNIGST
ISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLPGNPYNFTHDP
TIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMECP
SPSVAKRFTSIRRSERSAAASAQGTSSPHSLRLKESQLSLKIAFIMDNVESVKDLEKQSL
RNRLLYVEDPKFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLALT
QLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPITPGVIAG
IASTTFGLIFLFILALVIFRRKSTQADREAKRIQIQMDTLESNVRMECKQAFAELQTDMT
DLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLVN
NKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNTK
HPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHDA
RYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPFS
LRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQND
GFSVACKPPCHNCKPSHYHPQQQQQQQQQQQQQPSHHHHLHRHSNHCSSTHLPSTPNHGL
ISPVMYNHPVSGLYFDSQHSPPIITANGDVESAHDGNQRLYHLVRPIEDVHYPSGLGFTG
SSKHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDE
AAKQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSC
SMMEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHAN
EFDVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences XP_011875875.1.68811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]