SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011884591.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011884591.1.92194
Domain Number 1 Region: 494-815
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.22e-109
Family PDEase 0.0000000000121
Further Details:      
 
Domain Number 2 Region: 105-299
Classification Level Classification E-value
Superfamily GAF domain-like 2.01e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 285-489
Classification Level Classification E-value
Superfamily GAF domain-like 1.29e-37
Family GAF domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011884591.1.92194
Sequence length 833
Comment PREDICTED: cGMP-specific 3',5'-cyclic phosphodiesterase isoform X3 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MLPFGDKTREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKIS
ASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSH
LDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIR
LEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVA
QAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFE
EQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDMLTREH
DANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVSQQCIRSLLCTPIKNGKKN
KVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVT
LEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDL
NLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLE
ILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILS
GLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTA
CDLSAITKPWPIQQRIAELVASEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFID
AICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences A0A096NA83 A0A2K5LKW2 A0A2K5U1X6 A0A2K6AWN7
ENSPANP00000009587 XP_005555864.1.63531 XP_011747203.1.29376 XP_011884591.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]