SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011889522.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011889522.1.92194
Domain Number 1 Region: 21-144
Classification Level Classification E-value
Superfamily Lysozyme-like 1.96e-37
Family C-type lysozyme 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011889522.1.92194
Sequence length 146
Comment PREDICTED: lysozyme-like protein 4 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTQDGYIGFGLFQIRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKQG
MGAWPTWSRNCQYSDTLARWLDGCKL
Download sequence
Identical sequences A0A2K5N915 A0A2K6BN56 F6WRF5 G7NY74
NP_001181612.1.72884 XP_005546814.1.63531 XP_005546815.1.63531 XP_011737166.1.29376 XP_011889522.1.92194 XP_011889523.1.92194 XP_011889524.1.92194 XP_014986665.1.72884 ENSMMUP00000023139 9544.ENSMMUP00000023139 ENSPANP00000008380 ENSMMUP00000023139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]