SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011891118.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011891118.1.92194
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 1.27e-44
Family Globins 0.0000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011891118.1.92194
Sequence length 142
Comment PREDICTED: hemoglobin subunit theta-1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MALSAEDRALVRALWKKLGSNVGVYATEALERTFLAFPATKTYFSHLDLSPGSAQVRAHG
QKVADALSLAVERLDDLPRALSALSHLHACQLRVDPANFPLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALASEYR
Download sequence
Identical sequences A0A1K0GUX6 A0A2K5MX97 A0A2K5V9Y0 A0A2K6CQE3 A9L8U0
ENSMMUP00000032826 ENSMMUP00000032826 XP_002802384.1.72884 XP_005590789.1.63531 XP_011746863.1.29376 XP_011746864.1.29376 XP_011891118.1.92194 ENSPANP00000013425 9544.ENSMMUP00000032826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]