SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011895664.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011895664.1.92194
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-17
Family THAP domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011895664.1.92194
Sequence length 902
Comment PREDICTED: DNA transposase THAP9 isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MTRSCSAVGCSTRDTVLSRERGLSFHQFPTDTIQRSKWIRAVNRVDPRSKKIWIPGPGAI
LCSKHFQESDFESYGIRRKLKKGAVPSVSLYKIPQGVHLKGKARQKILKQPLPDNSQEVA
TEDHNYSLKTPLMIGAEKLAEVQQMLQVSKKRLISVKNYRMIKKRKGLRLIDALVEEKLL
SEETECLLRAQFSDFKWELYNWRETDEYTTEMKQFACTLYLCSSKVYDYVRKILKLPHSS
ILRTWLSKCQPSPGFNSNIFSFLQRRVENGDQLYQYCSLLIKSIPLKQQLHWDPSSHSLQ
GFMDFGLGKLDADETPLASETVLLMAVGIFGHWRTPLGYFFVNRASGYLQAQLLRLTIGK
LSDIGITVLAVTSDATAHSVQMAKALGIHIDGDDMKCTFQHPSSSSQQIAYFFDSCHLLR
LIRNAFQNFQSIQFINGIAHWQHLVELVALEEQELSNMERIPSTLANLKNHVLKVNCAAQ
LFSESVASALEYLLSLDLPPFQNCIGTIHFLRLINNLFDIFNSRNCYGKGLKGPLLPETY
GKINHVLIEAKTIFVTLSDTSNNQIIKGKQKLGFLGFLLNAESLKWLYQNYVFPKVMPFP
YLLTYKFSHDHLELFLNMLRQVLVTSSSPTCMAFQKAYHNLETRYKFQDEVFLSKVSIFD
ISIARRKDLALWTVQRQYGVSVTKTLFHEEGICQDWSNCSLSEALLDLSDHRRNLICYAG
YVANKLSALLTCEDCITALYASDLKASKIGSLLFVKKKNGLHFPSEGLCRVINICERVVR
THSRMAIFELVPKQRELYLQQKILCELSGHIYLFVDLNKHLFDGEVCAINHFVKLLKDII
ICFLNIRAKNVAQNPLKQSERTDMKTLSRKHWSSLQDYKCSSFANTSSKFRHLLSNDGYP
FK
Download sequence
Identical sequences A0A096MS39 A0A2K5M6M1
XP_011895664.1.92194 ENSPANP00000002599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]