SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011898843.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011898843.1.92194
Domain Number 1 Region: 42-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 250-364
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 453-490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 163-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 209-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 414-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011898843.1.92194
Sequence length 769
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X2 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MEKRAAAGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALACSGKLEQHTERRGVIYSPA
WPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCG
SAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPG
PWQCNAVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDCG
DGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDSRRVLLQLELR
LGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNAT
YQVKGYCLPWEQPCGSSSDSDGGSAGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQY
PCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQ
DGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLE
AEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSR
RRLGRLWNRLFHRPRVPRGQIPLLTAARPSQTVLGDGFLQPAPGAAPDPPAPLTDTGSPR
VAGDGPPSAPSHAPEVGPSGPPLPSGLRDPQCRPVDKDRKVCREPLADGPAPADAPREPC
SAQDPHPQASTASSTLGPHSPEPLGVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences XP_011898843.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]