SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011903601.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011903601.1.92194
Domain Number 1 Region: 9-306
Classification Level Classification E-value
Superfamily Aldolase 2.2e-70
Family Class I aldolase 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011903601.1.92194
Sequence length 320
Comment PREDICTED: N-acetylneuraminate lyase isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSI
SERRQVAEEWVTKGKDKLDQVVIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWT
KDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGIQDKIPTFQGLKFSDTDLL
DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFERKDLS
LALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKL
KSLDFLSFTDLKDGSLEASS
Download sequence
Identical sequences A0A096NG31 A0A2K5K283 A0A2K5MU34 G7MF42
ENSPANP00000011893 9544.ENSMMUP00000011776 XP_011797501.1.43180 XP_011903575.1.92194 XP_011903583.1.92194 XP_011903591.1.92194 XP_011903601.1.92194 XP_014977734.1.72884 XP_014977740.1.72884 XP_014977748.1.72884 XP_014977756.1.72884 XP_014977761.1.72884 ENSMMUP00000011775 ENSMMUP00000011776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]